PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 201aa    MW: 23148.7 Da    PI: 7.2357
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27441.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.8e-121759148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g +k+    +g  Rt+k+c++rw++yl
       KHN27441.1 17 KGPWTMEEDLILINYIANHGEG-PKL----LGDIRTGKSCRLRWLNYL 59
                     79********************.888....88778***********97 PP

2Myb_DNA-binding56.46.7e-1865108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l++++++++G++ W++Ia++++ gRt++++k++w++
       KHN27441.1  65 RGNITPEEQLLIIELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 108
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-161062IPR009057Homeodomain-like
PROSITE profilePS5129412.6391259IPR017930Myb domain
SuperFamilySSF466898.8E-2614106IPR009057Homeodomain-like
SMARTSM007172.8E-41661IPR001005SANT/Myb domain
PfamPF002497.8E-111759IPR001005SANT/Myb domain
PROSITE profilePS5129425.64160114IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2563114IPR009057Homeodomain-like
SMARTSM007172.5E-1664112IPR001005SANT/Myb domain
PfamPF002499.7E-1765108IPR001005SANT/Myb domain
CDDcd001672.23E-1369108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MDKKPCNSSS HDPEVRKGPW TMEEDLILIN YIANHGEGPK LLGDIRTGKS CRLRWLNYLR  60
PDVRRGNITP EEQLLIIELH AKWGNRWSKI AKHLPGRTDN EIKNFWRTRI QKHIKQAETS  120
QQHGNSENND HQASTSTSKV STMAHPNETF SPPSYQGTFE PFQPQFPTIT DQSSCCTTTN  180
DNNNYWSIED IWSSMQLLNG D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211422128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0898410.0BT089841.1 Soybean clone JCVI-FLGm-2P22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235699.11e-143uncharacterized LOC100305972
SwissprotP813914e-82MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0B2R0F91e-151A0A0B2R0F9_GLYSO; Myb-related protein 305
STRINGGLYMA05G08690.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-79myb domain protein 21
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]